SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N1NXD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N1NXD9
Domain Number - Region: 40-81
Classification Level Classification E-value
Superfamily Histone-fold 0.0178
Family TBP-associated factors, TAFs 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N1NXD9
Sequence length 353
Comment (tr|N1NXD9|N1NXD9_YEASC) Taf3p {ECO:0000313|EMBL:EIW07102.1} KW=Complete proteome OX=889517 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) (Baker's yeast). GN=CENPK1137D_1689 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MTTNNDFYFALLRISILQLLKAQGFDRARPSLVDVMTDLYAKFLSLLASEVSSIAQARCD
QDDTIALQDITLALENLGIVKPTNVLDVYDENSELSSSRGMEKFKDWCIYSTQLTDARIT
ALPTVELLQSEEKESDPLSAIPDYLNQLLQNKGAKQKLETKNRKTELIEDLINNNGLDDW
IKLVIARQRINMIERASKKESQNVPALPHIAGYKSSILSRHHHTTITNEDRMPSAMTPRD
EDALTEIQENPFVTSKLPIMRKENRLENITLSFEDEELESLGEVEGPNQKSQENNNEESF
KENNKSLTESPHGDDRDISMFQFDSNVDTKWAEQEDMDSTFQRRTSLDYGGYF
Download sequence
Identical sequences N1NXD9 Q12297
NP_015314.1.97178 YPL011C YPL011C YPL011C YPL011C 4932.YPL011C Pf-sce:YPL011C YPL011C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]