SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N1P1F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N1P1F1
Domain Number - Region: 162-267
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0917
Family Thioltransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) N1P1F1
Sequence length 284
Comment (tr|N1P1F1|N1P1F1_YEASC) Prm4p {ECO:0000313|EMBL:EIW06955.1} KW=Complete proteome OX=889517 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) (Baker's yeast). GN=CENPK1137D_1542 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MIADSSVLKKHTAIKRSTRIISLTLVLLGVFSFLLLTWNDSLEFYNSADPSENKKNSEEE
SEKKFVYKLPNLLKTADSFLSNENELNFQKVKEEISNIQSEVEVDIPEPSSKATSKFSSR
SFQTDNVVTATTTTTLNPRSSSLALQKNCDHKKFDPRTDFLDIIRTSPAVLFIKSSQADS
IFLKNLLQREFEISPELATVDLEKHSHGYELEKYIKQNKLNIDTSAALESIQSPYLFLNG
ISVINRGMVRDIIEPHSKGLLLPLLKSEARGNLLVEKKDIPSNS
Download sequence
Identical sequences N1P1F1 Q12498
YPL156C YPL156C YPL156C NP_015169.1.97178 YPL156C YPL156C 4932.YPL156C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]