SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N1P397 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N1P397
Domain Number 1 Region: 83-333
Classification Level Classification E-value
Superfamily vWA-like 8.89e-33
Family Trunk domain of Sec23/24 0.001
Further Details:      
 
Domain Number 2 Region: 508-626
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 5.23e-20
Family C-terminal, gelsolin-like domain of Sec23/24 0.0035
Further Details:      
 
Domain Number 3 Region: 18-56
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.00000144
Family Zn-finger domain of Sec23/24 0.0058
Further Details:      
 
Weak hits

Sequence:  N1P397
Domain Number - Region: 464-506
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 0.000162
Family Helical domain of Sec23/24 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N1P397
Sequence length 630
Comment (tr|N1P397|N1P397_YEASC) Uncharacterized protein {ECO:0000313|EMBL:EIW10186.1} KW=Complete proteome OX=889517 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) (Baker's yeast). GN=CENPK1137D_5431 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MCSPTNFLYEPFSSDAVTQNYDQNLKCTKCGAYYSMACSLREQNVWTCLFCNQSNSNAEL
PLVPSNTYTLTSAKKEILSRRTIMIIDAICDPHELNYLVSILCNNYITRQQEPLSIITIQ
QSGHVILHNAVNHRRDAVFSINEFMTKYNLDKLNASYFEKKISEINQESYWFDKSTQGSL
RKLLREICKIANKVNISSKRDKRCTGLALFVSSVLASQCSLSAYCHIVSFLNGPCTKGGG
KVMSRERGESMRQNHHFESKSSQLQLSKSPTKFYKKMLEKFANQSLIYEFFIASLDQIGI
LEMSPLITSSMAVSQFDSFNDERFAMSFQKYLNLRDHNAIYNCHSKIMTAKNAIVVKDFP
KYSLNPKNLSLPLEISLGHNSAEAPIQFQTTFENQTEKYIRIETLLLPKANRSFGAQNEI
VFSMKKIASRIIDSFAYSSKHTKELMKQLFLLPNQIRGKDVDMVNLIQWCYHIYRSPILS
VRNTSPDERYLFLHRIINASKDTCLSLCKPFIWSYSDLKHDWIVLDVPLTRAQILQDDKT
TICVDGGSYLVLRRGKLLEKEGRELCCKLLNDLQRFPQPLYVETKTGGSQDRFLKSKIIP
LDITDKETLGTEDMTFNEYFNLFTDLSGSK
Download sequence
Identical sequences N1P397 P38769
NP_011900.1.97178 YHR035W YHR035W 354891 YHR035W YHR035W 4932.YHR035W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]