SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N1P3R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N1P3R0
Domain Number 1 Region: 232-544
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-52
Family WD40-repeat 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) N1P3R0
Sequence length 566
Comment (tr|N1P3R0|N1P3R0_YEASC) Cdh1p {ECO:0000313|EMBL:EIW10351.1} KW=Complete proteome OX=889517 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) (Baker's yeast). GN=CENPK1137D_2969 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSTNLNPFMNNTPSSSPLKGSESKRVSKRPISSSSSASLLSSPSRRSRPSTVYGDRYIPS
RTDIDFNSIVSISSMASVPALNPSSTEDQVEYQKERQAHETYNTLLKNELFGEMLSKDTV
GSESSIDRIKNTRPSTRGNVHAENTTRHGYELERVSTPPPEAAGLEEFSPHSTPVTPRRL
FTSQQDEITRPSSNSVRGASLLTYQQRKGRRLSAASLLQSQFFDSMSPVRPDSKQLLLSP
GKQFRQIAKVPYRVLDAPSLADDFYYSLIDWSSTDVLAVALGKSIFLTDNNTGDVVHLCD
TENEYTSLSWIGAGSHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSG
SRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPI
LTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQICNMVWS
KNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLR
YWKLFDKPKAKVQPNSLIFDAFNQIR
Download sequence
Identical sequences G2WE91 N1P3R0 P53197
YGL003C YGL003C YGL003C YGL003C 4932.YGL003C NP_011512.1.97178 YGL003C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]