SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N1P4X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N1P4X5
Domain Number 1 Region: 75-140
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000000000301
Family Chaperone J-domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N1P4X5
Sequence length 146
Comment (tr|N1P4X5|N1P4X5_YEASC) Mdj2p {ECO:0000313|EMBL:EIW08165.1} KW=Complete proteome OX=889517 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) (Baker's yeast). GN=CENPK1137D_2752 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MVLPIIIGLGVTMVALSVKSGLNAWTVYKTLSPLTIAKLNNIRIENPTAGYRDALKFKSS
LIDEELKNRLNQYQGGFAPRMTEPEALLILDISAREINHLDEKLLKKKHRKAMVRNHPDR
GGSPYMAAKINEAKEVLERSVLLRKR
Download sequence
Identical sequences A0A250WGI8 N1P4X5 P42834
NP_014071.1.97178 XP_015331602.1.40921 YNL328C YNL328C YNL328C YNL328C YNL328C YNL328C YNL328C YNL328C 4932.YNL328C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]