SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N1P747 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N1P747
Domain Number 1 Region: 7-48
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000117
Family TBP-associated factors, TAFs 0.015
Further Details:      
 
Weak hits

Sequence:  N1P747
Domain Number - Region: 190-254,293-314
Classification Level Classification E-value
Superfamily Histone-fold 0.000335
Family TBP-associated factors, TAFs 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) N1P747
Sequence length 337
Comment (tr|N1P747|N1P747_YEASC) Spt3p {ECO:0000313|EMBL:EIW11603.1} KW=Complete proteome OX=889517 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) (Baker's yeast). GN=CENPK1137D_4221 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MMDKHKYRVEIQQMMFVSGEINDPPVETTSLIEDIVRGQVIEILLQSNKTAHLRGSRSIL
PEDVIFLIRHDKAKVNRLRTYLSWKDLRKNAKDQDASAGVASGTGNPGAGGEDDLKKAGG
GEKDEKDGGNMMKVKKSQIKLPWELQFMFNEHPLENNDDNDDMDEDEREANIVTLKRLKM
ADDRTRNMTKEEYVHWSDCRQASFTFRKNKRFKDWSGISQLTEGKPHDDVIDILGFLTFE
IVCSLTETALKIKQREQVLQTQKDKSQQSSQDNTNFEFASSTLHRKKRLFDGPENVINPL
KPRHIEEAWRVLQTIDMRHRALTNFKGGRLSSKPIIM
Download sequence
Identical sequences A0A0L8VUD5 A0A250W8E4 B3LFQ8 C7GSD0 C8Z5V6 G2WBD2 N1P747 P06844
YDR392W SCRT_00138 YDR392W YDR392W YDR392W YDR392W YDR392W YDR392W YDR392W NP_010680.1.97178 YDR392W 4932.YDR392W YDR392W YDR392W YDR392W YDR392W YDR392W YDR392W YDR392W YDR392W YDR392W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]