SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N1QTV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N1QTV0
Domain Number 1 Region: 71-212
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.13e-29
Family UAS domain 0.054
Further Details:      
 
Domain Number 2 Region: 331-411
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.65e-16
Family UBX domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) N1QTV0
Sequence length 479
Comment (tr|N1QTV0|N1QTV0_AEGTA) Uncharacterized protein {ECO:0000313|EMBL:EMT01048.1, ECO:0000313|EnsemblPlants:EMT01048} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_17887 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MSSSSARDGAGGSSRNYRSGFARNLARFPSSIVEGLSRSIARRAPRSRPGGIQVQHHQPP
PQGPPLPASPPPFVPEELFFFSAFEQQYGGPHPFFYGCRLSEVLAIARREGKHVFVYLHD
PGHPYTEPFCRGTLCSDVVVEFLDANFVSWGAVTGRGEGSGMAASLQPGSFPFCAVVAPV
SSESITVLQRVEGPVTPSELVEMLQRTIDEQRVAFRASLADEQAAAFRASRAEEEERRRS
ALRLRQEQDAAYLESLRKDQVQEQFSFCSAVQCTCPVPQTRMSHLAVSVQEKERLAKSFQ
EGAVKPKAKAKPSTKYPGQAGGETTRTTQIRAPTHKETAPSHRTEANTKIMIRFPNGERR
QQSFRHTDTIREIYKYVNSLGMPGIGRYQLVRSYPRKTYGHQQLEMNLGDAAPCSKRTQT
NQSLPAQHRQELGALLQLLHLQFDPYSMFNHPPAELVLRVPKFWLRKPTQLVAERNPEE
Download sequence
Identical sequences N1QTV0
EMT01048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]