SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N1RZ75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N1RZ75
Domain Number 1 Region: 221-406
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.92e-42
Family Glutathione peroxidase-like 0.00082
Further Details:      
 
Domain Number 2 Region: 3-97
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.14e-30
Family PHBH-like 0.00019
Further Details:      
 
Domain Number 3 Region: 91-181
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.96e-18
Family FAD-linked reductases, N-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N1RZ75
Sequence length 409
Comment (tr|N1RZ75|N1RZ75_FUSC4) Phenol 2-monooxygenase {ECO:0000313|EMBL:EMT67550.1} KW=Complete proteome; Reference proteome OX=1229665 OS=fungus). GN=FOC4_g10005649 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MVGDSSDSVWGVMDVYPVTNFPDIRKKAMLQSKSDGNLMIIPREGDELVRFYIELSGTSA
RDVTEQDLINKVKRIFHPYDIDIARTVWWSAYVIGQRLADHFTKDHRIFLTGDACHTHSP
KAGQGMNVSLQDGFNIGWKMAHVLTGRAPPSVLETYVFERQQTAQQLIEFDRSFSKLFSS
EYRKANGITAKHFRDKFVEAGRYTAGMATRYKPSIVTSLEESDNSIASGLTVGMRFPSAP
VVRLSDTKPMQLNKNLAADGRWHVLTFCSGDFARKGLHEYLRQLTILQVARELGNLIKMF
TPAGDPVDKVFSHTLLIKAERKTIEIDQLPEVFFPHTGPYNLRNVHRVFVDDTNPYMLGC
GQAFSKYGIDAEQGAIVVVRPDLYTARVLSLSQVADLFTFFKGCLSSIG
Download sequence
Identical sequences N1RZ75

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]