SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N4WVV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N4WVV8
Domain Number 1 Region: 5-211
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.67e-35
Family DsbA-like 0.0033
Further Details:      
 
Domain Number 2 Region: 256-478
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.04e-29
Family DsbA-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) N4WVV8
Sequence length 507
Comment (tr|N4WVV8|N4WVV8_COCH4) Uncharacterized protein {ECO:0000313|EMBL:ENI04674.1} KW=Complete proteome OX=665024 OS=(Southern corn leaf blight fungus) (Bipolaris maydis). GN=COCC4DRAFT_169992 OC=Pleosporaceae; Bipolaris.
Sequence
MASSPPTLIFNYDISCPFAYIASTRVQSLARRTNATLIYHPVLLGAIYRATAAPQGAGGS
ASDVFNSTKKSVTATGMQRTLSRYQIPYHPPPKHPRKTVNALRMLYCVPEQDKRRQLTDR
LFRAYWVEGRDVNDDAVLLEIAREAGIHGLDRACFANAEARGELERETGLAIERGAFGVP
GFWIPGAGEREGGGRFFWGQDRMHFVEATLLGLSVAAAAGSGKGGQDAWVGVKNLRSLLP
RVVHSNQLPFASKSAVRLEFWFDFSSPWAFLGYTQLARLQRTFGPGLEIVLKPFLLGILF
RQIGAPNMPMMAVSQAKAEWSRRDHADWTRWWNAVDVQEGQQEGGKGKDGPIKFYWADKF
PIRTPTVLRVGIVEPAATKVLYSACWEQNKDVADEAVLQSVLDEAGFNGSDLIARANSPA
VKEKLRALTAEAKELGLCGAPTYRVLRRQQDGEFKPVGGLVWGQDEISVVEDLIAGWSPE
ESNGQVAEVGKVMYEDVQGGKSVGAKL
Download sequence
Identical sequences M2T5T5 N4WVV8
XP_014078583.1.79200 jgi|CocheC5_1|96988|estExt_Genewise1Plus.C_10266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]