SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N9UT46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N9UT46
Domain Number 1 Region: 11-296
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 6.72e-40
Family ROO N-terminal domain-like 0.0000554
Further Details:      
 
Domain Number 2 Region: 263-410
Classification Level Classification E-value
Superfamily Flavoproteins 5.68e-36
Family Flavodoxin-related 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N9UT46
Sequence length 415
Comment (tr|N9UT46|N9UT46_ENTHI) Type A flavoprotein fprA, putative {ECO:0000313|EMBL:ENY63837.1} KW=Complete proteome OX=885318 OS=Entamoeba histolytica HM-1:IMSS-A. GN=EHI7A_066090 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MTLKALKVCENLYWVGALDNDLRVFDIIMSTPYGTSYNSFLLTTSEGNILFETVKENFAQ
ECLSRVIDVIGESGKIDYIVCNHTEPDHSGSLVHILEKFPQATVIATFAALTNIKYIGHI
TKKTKTIDSTKNKQFKLGQYTLNFFIQPFLHWPDTMMTVIPELKVLLPCDVFGAHCADPR
VFNDEMTDRIKDLDDAYKHYFDCIFGPYTSFVLKGINILENDIGFPVDELKAICCSHGPV
LRTNIKENIERYKKWSQPKVLKDRVIIAYGSAYGYTEMMAEKIAEGVKSVGVEVIMHNIV
TSSVDAILNDFENSKGLLLGTPTLVGEALPPMYIILAHLNPIVHCSRYVQCFGTYGWSCE
GVRNLSVRIDQLMVRRPVRPLSFRFKPTEENLKECFEWGKTFATALLQNKEFVSE
Download sequence
Identical sequences A0A175JLL6 C4M0C2 M2RLK5 M3TTF0 M7X0C1 N9UT46
jCVI|EHI_064530 gi|56471042|gb|EAL48641.1| gi|67477004|ref|XP_654023.1| XP_654023.1.49425 294381.C4M0C2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]