SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N9V434 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N9V434
Domain Number - Region: 84-135
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000903
Family Tudor domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) N9V434
Sequence length 218
Comment (tr|N9V434|N9V434_ENTHI) Uncharacterized protein {ECO:0000313|EMBL:ENY63948.1} KW=Complete proteome OX=885318 OS=Entamoeba histolytica HM-1:IMSS-A. GN=EHI7A_032660 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MEQIEQLENAITQQELDLKDLNELLVEDSTNEEILSLKKEAETTLNTLKKQLEQYRLTIL
SSKEELKLTNNSSSNNTNETKTIYFKPNDQVIAWSQRDNGWFAAMITRPSNNQMYWVRFG
PRDNQLVSLDKIKPFSDINSVQLSSINTSKIKIRKLPKKTITELPKWTKPKPNDTEKDLL
LKRKKRHQLKSLMKQQKEEEDLETKKNSWKAFASKMKK
Download sequence
Identical sequences A0A175JXM4 C4M9V1 K2GCS9 M2RIS4 M3TZZ7 M7WF87 N9V434
294381.C4M9V1 gi|56466113|gb|EAL44245.1| gi|67467022|ref|XP_649631.1| XP_008857310.1.50645 XP_649631.1.49425 jCVI|EHI_036840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]