SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O02316 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O02316
Domain Number 1 Region: 169-359
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.65e-27
Family Nuclear receptor ligand-binding domain 0.0076
Further Details:      
 
Domain Number 2 Region: 10-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.97e-20
Family Nuclear receptor 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O02316
Sequence length 362
Comment (sp|O02316|NHR77_CAEEL) Nuclear hormone receptor family member nhr-77 KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=nhr-77; OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MPIVELADPICPVCEFPSNVELHFGGLVCGACAAFFRRTVSLNIRYLCEKNNQCKGMRKN
CRACRFDYCVKIAGMKRNLVKQRRNSTNTPMYILNRRKDSGNEEVVRGMLKRMYLQFSSF
SGFVTTTQSKWAHHSRKSSMSPNKEAEKDVSKILKISHGSLLKYYIYQITHDKRNNMNTL
NIKSVEEFLEITSVQNKLAAELCKTCPGVDLLDNEDILILRKYFQFSNVWIESTWNYLRE
NNSVPIDDSELDLKLLKFINQVKSTLLVSFSQLKFNTIEFAAFKSICIWKLVYHETSRAM
KIIAQEHYESVMKALNDYYQTYTSMDSMQIATRIGEITLLIISVFQMYHDMAKLYIQLGL
PF
Download sequence
Identical sequences O02316
6239.T15D6.6 T15D6.6 T15D6.6 T15D6.6 NP_493137.2.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]