SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O08849 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O08849
Domain Number 1 Region: 72-200
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.67e-46
Family Regulator of G-protein signaling, RGS 0.00000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O08849
Sequence length 211
Comment (sp|O08849|RGS2_MOUSE) Regulator of G-protein signaling 2 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Rgs2; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MQSAMFLAVQHDCVPMDKSAGNGPKVEEKREKMKRTLLKDWKTRLSYFLQNSSAPGKPKT
GKKSKQQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKSLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT
Download sequence
Identical sequences O08849
10090.ENSMUSP00000115558 NP_033087.2.92730 ENSMUSP00000115558 ENSMUSP00000115558 ENSMUSP00000115558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]