SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O08912 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O08912
Domain Number 1 Region: 95-421
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 7.22e-70
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000000000545
Further Details:      
 
Domain Number 2 Region: 425-553
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.37e-40
Family Ricin B-like 0.000000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O08912
Sequence length 559
Comment (sp|O08912|GALT1_MOUSE) Polypeptide N-acetylgalactosaminyltransferase 1 soluble form KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Galnt1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MRKFAYCKVVLATSLVWVLLDMFLLLYFSECNKCEEKQERGLPAGDVLELVQKPHEGPGE
MGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSV
VIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHV
IRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDV
ISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDR
DYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQ
IINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYP
DSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDD
LCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDC
TGSRSQQWLLRNVTLPEIF
Download sequence
Identical sequences O08912
NP_001153876.1.92730 NP_038842.3.92730 XP_006525713.1.92730 ENSMUSP00000000430 10090.ENSMUSP00000000430 ENSMUSP00000000430 ENSMUSP00000000430 ENSMUSP00000132142 ENSMUSP00000137427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]