SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O15232 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O15232
Domain Number 1 Region: 65-263
Classification Level Classification E-value
Superfamily vWA-like 2.36e-54
Family Integrin A (or I) domain 0.00019
Further Details:      
 
Domain Number 2 Region: 268-390
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000212
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 392-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000051
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 442-479
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000114
Family Chicken cartilage matrix protein 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O15232
Sequence length 486
Comment (sp|O15232|MATN3_HUMAN) Matrilin-3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MATN3; OC=Catarrhini; Hominidae; Homo.
Sequence
MPRPAPARRLPGLLLLLWPLLLLPSAAPDPVARPGFRRLETRGPGGSPGRRPSPAAPDGA
PASGTSEPGRARGAGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADT
RVAVVNYASTVKIEFQLQAYTDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEAFTVEAGA
REPSSNIPKVAIIVTDGRPQDQVNEVAARAQASGIELYAVGVDRADMASLKMMASEPLEE
HVFYVETYGVIEKLSSRFQETFCALDPCVLGTHQCQHVCISDGEGKHHCECSQGYTLNAD
KKTCSALDRCALNTHGCEHICVNDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQ
HICVNDRTGSHHCECYEGYTLNADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPG
YTLNEDKKTCSATEEARRLVSTEDACGCEATLAFQDKVSSYLQRLNTKLDDILEKLKINE
YGQIHR
Download sequence
Identical sequences O15232
ENSP00000383894 GO.97965 ENSP00000383894 9606.ENSP00000383894 NP_002372.1.87134 NP_002372.1.92137 ENSP00000383894 gi|11321565|ref|NP_002372.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]