SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O15269 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O15269
Domain Number 1 Region: 58-469
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.83e-82
Family GABA-aminotransferase-like 0.0000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O15269
Sequence length 473
Comment (sp|O15269|SPTC1_HUMAN) Serine-palmitoyl-CoA transferase 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SPTLC1; OC=Catarrhini; Hominidae; Homo.
Sequence
MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEEL
IEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAA
ALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSK
RGDIVFVDRAACFAIQKGLQASRSDIKLFKHNDMADLERLLKEQEIEDQKNPRKARVTRR
FIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDI
DLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENP
GIFAVLKEKCGQIHKALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCM
NRSIALTQARYLEKEEKCLPPPSIRVVVTVEQTEEELERAASTIKEVAQAVLL
Download sequence
Identical sequences A0A024R277 O15269
9606.ENSP00000262554 Hs5454084___KOG1358 ENSP00000262554 NP_006406.1.87134 NP_006406.1.92137 ENSP00000262554 gi|5454084|ref|NP_006406.1| ENSP00000262554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]