SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O15539 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O15539
Domain Number 1 Region: 54-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.2e-45
Family Regulator of G-protein signaling, RGS 0.00000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O15539
Sequence length 181
Comment (sp|O15539|RGS5_HUMAN) Regulator of G-protein signaling 5 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RGS5; OC=Catarrhini; Hominidae; Homo.
Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQ
WRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEF
IQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELI
K
Download sequence
Identical sequences A0A024R8X9 O15539
ENSP00000319308 NP_003608.1.87134 NP_003608.1.92137 ENSP00000319308 9606.ENSP00000319308 gi|4506519|ref|NP_003608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]