SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O15663 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O15663
Domain Number 1 Region: 2-162
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.02e-31
Family Duffy binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O15663
Sequence length 174
Comment (tr|O15663|O15663_PLAFA) PfEMP1 {ECO:0000313|EMBL:AAB87401.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=PfEMP1 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
EDKIMSYNAFFWDWVYHMLHDSLDWRKQLGNCINKDNGNKCKSGCNTKCKCFEKWVEQKG
KEWKAIKEHFDKQKDIPDGRYFLTLEGVLEKGVLLTSIKEGYGNERDIEHIKQLLDEEEA
AGALGGGGAALGGLYTHGPVAGQDTTIDKILQHEDKDATKCKNCKPPEDRSVAR
Download sequence
Identical sequences O15663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]