SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O16752 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O16752
Domain Number 1 Region: 2-207
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.13e-22
Family Nuclear receptor ligand-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O16752
Sequence length 212
Comment (tr|O16752|O16752_CAEEL) Nuclear Hormone Receptor family {ECO:0000313|EMBL:CCD72147.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_F59E11.10 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MDMERAATWLTYFDEFCTLKSEEKMLITKCMWLLFRRLERSAMTADLRRAKKCQKSEYAM
KTDSLVSMETKYEFDWLSHFSAEQIKVFLGSSSGMYCEELTNCIMEVQPSDEELCFIICD
LCFQYLGIKVGGEIQQKLEGLQKILSDNLHNYYLERNREHRYTYRLSQLMKISQQYNKLM
EEKRRVGVVGEVFGVFRVKWSHPDIFKYARFE
Download sequence
Identical sequences O16752
NP_001256112.1.50509 6239.F59E11.10 F59E11.10 F59E11.10a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]