SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O16960 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O16960
Domain Number 1 Region: 161-388
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.03e-34
Family Nuclear receptor ligand-binding domain 0.012
Further Details:      
 
Domain Number 2 Region: 6-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-22
Family Nuclear receptor 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O16960
Sequence length 393
Comment (tr|O16960|O16960_CAEEL) Nuclear Hormone Receptor family {ECO:0000313|EMBL:CCD64478.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_R11G11.2 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MLISIEFCKICDRKSQGIHFGVPSCRACAAFFRRRAGSDLVEKSCMNKKCGKEFFLCKPC
RLVRCYAVGMDEKKFQFDRDALASTVLLNTIPKSFDKFVGRPQFVHFCDPSAPSTSKFID
VRLLVEKGENILKSGPSWTPHMNKGPLFKLANFHNVFTKMPVNMATNNVFSRGDCSDCWE
YYFLTTATWLTNFDEFQKLEHPVKMKILFAIWHMWGRMDKLACTALARRRQQLSAKSEIA
QSNGLFLDVDTLALDVSWISEFKLEEVEFFIDGFRNWDLMELVQVFVELDPTPIELNYML
AQMSFYYAGNRFQGEILEIMDRFQQILSDDLHKYYVNERHTSNYSGRLSRLLKINNAVQS
SVRKRRPKTDIAKTLNIFTAEFSHPEMFFDTGF
Download sequence
Identical sequences O16960
R11G11.2a 6239.R11G11.2a NP_503236.1.50509 R11G11.2a R11G11.2a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]