SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O17082 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O17082
Domain Number 1 Region: 158-361
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.09e-35
Family Nuclear receptor ligand-binding domain 0.0075
Further Details:      
 
Domain Number 2 Region: 12-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.68e-24
Family Nuclear receptor 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O17082
Sequence length 399
Comment (sp|O17082|NH125_CAEEL) Nuclear hormone receptor family member nhr-125 KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=nhr-125; OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MDLVSTSTSPFSCRICNQKAHGNHFGVLTCRACASFFRRAAFSKWSQLKCQKGGCSRNFC
KRCRLKKCREMGMDTTKFQYNRDSFRATGQFQLPPPRSLASFVGRPELFLFCDTEAPNAK
MLIDVRYLLEEAGRIINQGYETPASGKNQLENLTEGFKYIKVDMNNISSSKYASKDAIIS
MWEYYFFTVTRWLMYFEGFQKLNSHTQITLIQSVWNVWSRLHKYVATVDYHKANPDTLPT
NVVIHNTLVDIENVEFDSTWLSDYPVEHVRRYLSVQHCREFDILGTLRKLNPSELEITYL
FAQICFEHAGKRNQGDIMKVTEQFLDSLANDLHDYYVNEMNNSRYFLRLTQLLKINQAIQ
FSDISPQKQIRNNIIKKEAEKLEKLQKSQFSIKRLSISN
Download sequence
Identical sequences O17082
R02D1.1 NP_504194.2.50509 R02D1.1 6239.R02D1.1 R02D1.1 R02D1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]