SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O17934 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O17934
Domain Number 1 Region: 129-355
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.13e-24
Family Nuclear receptor ligand-binding domain 0.0073
Further Details:      
 
Domain Number 2 Region: 21-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-19
Family Nuclear receptor 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O17934
Sequence length 405
Comment (sp|O17934|NH199_CAEEL) Nuclear hormone receptor family member nhr-199 KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=nhr-199; OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MFTLARVLNNIGSASSNEPIPYCLICSEVADGNHFGVAAACRACAAFFRRTVQHNKIHEC
GRNGQCFFLSCKFLLVGFQISPLSSDARSMCKACRYGKCLEMGMQRSSVQQRREQLGKRL
NISDDRGKPVLNKLRRAYEMLILNRKHVHNRRENQAPRAIGFNELPIVFQNESTSIYQFL
WEAFPEYSMLLPDTKLAFFKNFFLSFCLFESSFNGCSAKQKNVMLIPSGDYIDLAHSESF
FTNDHQTFTERDNIEILAQRLKLIQSSITVPLSAENVDIYEFLALAGIILLESDSESEAD
FQEEAVKIKSNIIKDLLFHYQCINIYDDAAMRLGAVLSILPSIQVCCSRSNNFLIINSKD
VSESQSPFSRIHGNQKYAQFVRSSQESLRHVLANFIKFICKFVSI
Download sequence
Identical sequences O17934
K06B4.10 NP_506905.1.50509 K06B4.10 K06B4.10 6239.K06B4.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]