SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O18087 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O18087
Domain Number 1 Region: 12-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.67e-26
Family Nuclear receptor 0.00094
Further Details:      
 
Domain Number 2 Region: 133-352
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.59e-22
Family Nuclear receptor ligand-binding domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O18087
Sequence length 355
Comment (sp|O18087|NH127_CAEEL) Nuclear hormone receptor family member nhr-127 KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=nhr-127; OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MKITFSPELSIPCEVCKNQSNGYHFEVLSCGACASFFRRSVVSKIKYQCKDGKKRCQIRY
LDRHFCRYCRFSKCVKAGMKAEKIQKNRDLDSSPTPTDQNNCIPSDVLHDDGILIKDIRG
LFKQFNPHNASEGCSKLEKLTEGLQFIRRNQERECIKIIDEMDSESLKDVQFKVIGSCAT
WLLFSSFFQKLEENEKVVILERLWHGWTVLEFLSRSLEIFGNKVIDEKIVFISDNTAIRL
ITAFENSLKTASPKKSESIKKKLELSFSVIFDELALHFINWKPTEIEISYMQWQIVWSVA
EQLLSGNSLEKGEHFTEQLSKDLHEYYVRELKLENYAFRIEKMMDIVQIVQNNFY
Download sequence
Identical sequences O18087
T13F3.3 T13F3.3 T13F3.3 6239.T13F3.3 T13F3.3 NP_507104.2.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]