SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O18231 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O18231
Domain Number 1 Region: 213-416
Classification Level Classification E-value
Superfamily Serpins 1.57e-16
Family Serpins 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O18231
Sequence length 535
Comment (tr|O18231|O18231_CAEEL) Uncharacterized protein {ECO:0000313|EMBL:CAB16507.4} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_Y57G11C.5 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSNNSKSTESRNKSQTSWNPFRKMLSMVTGRTGSESNSNTSDGEKTILRWTTACLTTTCP
IFSRNPQFNMIYCPVPSLLMYVIITLASENAMTKTLHRLFELTDSDVDEIREMAQKLAEL
QHPKHFYCFIRFLVDEQETTTVSKELMIKSNDVAFQQVFASFRPSRITKFLNSLTFSPVS
LNRPSLLTTNGYGSAGLNATWIGKTRKAGLNRFACTYHKKKNEEFFEIRTAYRTINMEQF
QVFEIPFKFGLSSACFGSLLILRPHLIGSLPYANRQLTTQSLSKMLDELYTAQWITEGRL
LLPQFSVDSCHDLWKNLMRHGVQPDLGQSQKAPPMASLWHWAHLRVGSEGIRGNVMTKKN
GAKLTASQKALQNTFHNRVDSDSLLKKHQSYAARIDSPFTYLVMVQGIPIFTGSYFGAPP
PKSTEIFINAPERIRHHRTYITKHRRYPKETRKQKLMRRVRKSEDREKEKDKKRARKEQK
NQKVENLEQSTTASSTSSLSSPEITVSKKPEIKNDDKSKSKGWRHLANRIFKRKN
Download sequence
Identical sequences O18231
Y57G11C.5a NP_001255826.1.50509 Y57G11C.5a Y57G11C.5a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]