SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O18683 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O18683
Domain Number 1 Region: 22-128
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-28
Family SH2 domain 0.0000547
Further Details:      
 
Domain Number 2 Region: 329-431
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-22
Family SH2 domain 0.0000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O18683
Sequence length 506
Comment (tr|O18683|O18683_DROME) p60 protein {ECO:0000313|EMBL:CAA73100.1} OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG2699 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MQPSPLHYSTMRPQAPGSLVDPNEDELRMAPWYWGRISREEAKSILHGKPDGSFLVRDAL
SMKGEYTLTLMKDGCEKLIKICHMDRKYGFIETDLFNSVVEMINYYKENSLSMYNKTLDI
TLSNPIVRAREDEESQPHGDLCLLSNEFIRTCQLLQNLEQNLENKRNSFNAIREELQEKK
LHQSVFGNTEKIFRNQIKLNESFMKAPADAPSTEAGGAGDGANAAASAAANANARRSLQE
HKQTLLNLLDALQAKGQVLNHYMENKKKEELLLERQINALKPELQILQLRKDKYIERLKG
FNLKDDDLKMILQMGFDKWQQLYETVSNQPHSNEALWLLKDAKRRNAEEMLKGAPSGTFL
IRARDAGHYALSIACKNIVQHCLIYETSTGFGFAAPYNIYATLKSLVEHYANNSLEEHND
TLTTTLRWPVLYWKNNPLQVQMIQLQEEMDLEYEQAATLRPPPMMGSSAPIPTSRSREHD
VVDGTGSLEAEAAPASISPSNFSTSQ
Download sequence
Identical sequences O18683
FBpp0077791 FBpp0077791 7227.FBpp0077791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]