SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O30295 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O30295
Domain Number 1 Region: 280-374
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0000000000000113
Family Cellulose-binding domain family III 0.0038
Further Details:      
 
Domain Number 2 Region: 74-250
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0000000000183
Family Tricorn protease N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 435-489
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000147
Family Type I dockerin domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O30295
Sequence length 506
Comment (tr|O30295|O30295_ARCFU) Uncharacterized protein {ECO:0000313|EMBL:AAB91294.1} KW=Complete proteome; Reference proteome OX=224325 OS=9628 / NBRC 100126). GN=AF_2375 OC=Archaeoglobaceae; Archaeoglobus.
Sequence
MRSLRANGYNFRQDTRHYVYVVSQSNNWQQGRHLIDDPGKFYFDPLLDENGNHITVNYWV
YLDDFNWPNFIGTYTATGSAIGGIELGKYVYGPVRSPDGSKIAFSTVRGEGEQRVSELYV
GGVGQPPKIIYSDSEGRAVRQFSVSNDGKVAFYLEGDSKGREGVFLYQNGNIMLLNSDLH
FCNPMISGDGQKLYCLYNDLFEYKFSLYEIDINDGSYEMLGTYNVHTGLSLTNNDGSVIV
FRGYNETNGFGIFALVKGEGVTIPPMLNLDLQPMLPPKTTIIAGSAEAPQGSDIQVPVKI
ENADKVGSINLILSYPNVLEVEDVLQGSLTQNSLFDYNVEGNQIKVGIADSNGISGDGSL
FYVKFRVTGNEKAEQAENVKGKLRGLGQQLSEITLRNSHALTLQGIEIYDIDGNSVKVAT
INGTFRIVSQEEANKGDVNGDGEINSLDALLALQMSIGKVEPNPVADMDGDGKVLAKDAT
EIMKMATDMMIRRTAEIISQNGLLGK
Download sequence
Identical sequences O30295
224325.AF2375 gi|11499952|ref|NP_071198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]