SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O35598 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O35598
Domain Number 1 Region: 219-455
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.87e-52
Family TNF-alpha converting enzyme, TACE, catalytic domain 0.0000893
Further Details:      
 
Domain Number 2 Region: 467-547
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.00000000000772
Family Blood coagulation inhibitor (disintegrin) 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O35598
Sequence length 749
Comment (sp|O35598|ADA10_MOUSE) Mammalian disintegrin-metalloprotease KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Adam10; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MVLPTVLILLLSWAAGLGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKRAVSHEDQFL
LLDFHAHGRQFNLRMKRDTSLFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVI
DGRFEGFIKTRGGTFYIEPAERYIKDRILPFHSVIYHEDDINYPHKYGPQGGCADHSVFE
RMRKYQMTGVEEGARAHPEKHAASSGPELLRKKRTTLAERNTCQLYIQTDHLFFKYYGTR
EAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTSDEKDPTNPFRFPNIGVEK
FLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLN
TGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYA
RATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQC
KDDCCFDANQPEGKKCKLKPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAKEGICNGF
TALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKYDLEECTCASSDGKDDKELCHVCCM
KKMAPSTCASTGSLQWSKQFSGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKK
AIFSPQLYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGT
LKRRRPPQPIQQPPRQRPRESYQMGHMRR
Download sequence
Identical sequences O35598
10090.ENSMUSP00000063839 NP_031425.2.92730 ENSMUSP00000063839 ENSMUSP00000063839 ENSMUSP00000063839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]