SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O43680 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O43680
Domain Number 1 Region: 77-149
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.4e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O43680
Sequence length 179
Comment (sp|O43680|TCF21_HUMAN) Podocyte-expressed 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TCF21; OC=Catarrhini; Hominidae; Homo.
Sequence
MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRR
KAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDT
LRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS
Download sequence
Identical sequences A0A2K6GYS4 G3QRT2 H2PKD4 H2QTS0 O43680
9598.ENSPTRP00000031786 9600.ENSPPYP00000019060 9606.ENSP00000237316 ENSP00000237316 gi|38202237|ref|NP_003197.2| gi|38202239|ref|NP_938206.1| ENSP00000237316 ENSP00000356857 ENSGGOP00000005345 ENSP00000237316 ENSP00000356857 NP_003197.2.87134 NP_003197.2.92137 NP_938206.1.87134 NP_938206.1.92137 XP_002817433.1.23681 XP_003827728.1.60992 XP_004044754.1.27298 XP_006834714.1.41390 XP_008951265.1.60992 XP_009240545.1.23681 XP_009450301.1.37143 XP_012520647.1.63892 XP_518871.2.37143 ENSPPYP00000019060 ENSGGOP00000005345 ENSPTRP00000031786 ENSPTRP00000031786 ENSPPYP00000019060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]