SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O45449 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O45449
Domain Number 1 Region: 8-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-23
Family Nuclear receptor 0.0012
Further Details:      
 
Domain Number 2 Region: 95-332
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.75e-21
Family Nuclear receptor ligand-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O45449
Sequence length 338
Comment (sp|O45449|NH108_CAEEL) Nuclear hormone receptor family member nhr-108 KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=nhr-108; OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSKKSENQPCMVCGEISYSIRFGAVSCRACAEFFRRKIVSKARIPKRCNGACDLGKYHRK
TCQSCRFQKCLKIGMLEKVVASRTPVNRRSENNQTILSGLEKAYDKLENSRDNVFDRKNK
IPKYCNHQELDDMFEIDIKLISTHFIQFFESKSSLENNQNKVLSTHFIIRFSLLEVAFRA
FGKPTYILPNNDIIDVSKLDKVYQHLETGEDERGKNSQVILQRFWQMNEKTMKTEVFPVN
LDQSEFLFLCALIYWDFGIENQSEKCLEECQRMRTQVLKELTEYEKSNYPENELRVAQVI
GILQALQKTLDVIQHSGYISNVYNLKGKQCPLYEATNE
Download sequence
Identical sequences O45449
NP_506987.1.50509 F35E8.12 6239.F35E8.12 F35E8.12 F35E8.12 F35E8.12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]