SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O54949 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O54949
Domain Number 1 Region: 142-431
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-90
Family Protein kinases, catalytic subunit 0.000000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O54949
Sequence length 527
Comment (sp|O54949|NLK_MOUSE) Nemo-like kinase KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Nlk OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSLCGTRANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
Download sequence
Identical sequences D3ZSZ3 K9J1M2 O54949 U3EBF5
ENSMUSP00000119345 ENSRNOP00000011726 ENSMUSP00000119345 ENSMUSP00000119345 NP_001178853.1.100692 NP_001178853.1.4139 NP_032728.3.92730 XP_021068265.1.100879 ENSRNOP00000011726 10090.ENSMUSP00000119345 10116.ENSRNOP00000011726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]