SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O55033 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O55033
Domain Number 1 Region: 232-370
Classification Level Classification E-value
Superfamily SH2 domain 8.19e-27
Family SH2 domain 0.00046
Further Details:      
 
Domain Number 2 Region: 116-170
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-21
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 3 Region: 197-279
Classification Level Classification E-value
Superfamily SH3-domain 9.22e-21
Family SH3-domain 0.000031
Further Details:      
 
Domain Number 4 Region: 5-60
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-18
Family SH3-domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O55033
Sequence length 380
Comment (sp|O55033|NCK2_MOUSE) SH2/SH3 adaptor protein NCK-beta KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Nck2; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MTEEVIVIAKWDYTAQQDQELDIRKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTRRKPSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSFNGQIGWFPSNYVLEEADEAAAEAPSFL
SLRRGTALSNGQGARVLHVVQTLYPFSSVTEEELSFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALHPAHTPQISYTGPSASGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGRNKHFKVQLVDSVYCIGQRRFHSMDELVEHYK
KAPIFTSEHGEKLYLVRALQ
Download sequence
Identical sequences O55033
ENSMUSP00000083611 NP_035009.3.92730 XP_021053686.1.100879 ENSMUSP00000083611 10090.ENSMUSP00000110392 ENSMUSP00000083611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]