SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O60682 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O60682
Domain Number 1 Region: 105-182
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.49e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O60682
Sequence length 206
Comment (sp|O60682|MUSC_HUMAN) Class A basic helix-loop-helix protein 22 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MSC; OC=Catarrhini; Hominidae; Homo.
Sequence
MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCA
LGTAGSAEGCKRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARM
RVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTW
PFVVSGRPDSDTKEVSAANRLCGTTA
Download sequence
Identical sequences K7A6B3 O60682
ENSGGOP00000009716 ENSP00000321445 ENSP00000321445 ENSGGOP00000009716 9598.ENSPTRP00000040250 9606.ENSP00000321445 gi|116805332|ref|NP_005089.2| ENSP00000321445 HR4485 ENSPTRP00000040250 ENSPTRP00000040250 NP_005089.2.87134 NP_005089.2.92137 XP_003831377.1.60992 XP_004047190.1.27298 XP_016815055.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]