SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O61307 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O61307
Domain Number 1 Region: 1173-1445,1472-1498
Classification Level Classification E-value
Superfamily NHL repeat 3.14e-21
Family NHL repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 864-954
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000051
Family Pre-dockerin domain 0.047
Further Details:      
 
Weak hits

Sequence:  O61307
Domain Number - Region: 614-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000478
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 583-606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00111
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 547-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00203
Family Integrin beta EGF-like domains 0.056
Further Details:      
 
Domain Number - Region: 713-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family Integrin beta EGF-like domains 0.077
Further Details:      
 
Domain Number - Region: 518-542
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family EGF-type module 0.098
Further Details:      
 
Domain Number - Region: 2219-2333
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.0353
Family Cell wall binding repeat 0.016
Further Details:      
 
Domain Number - Region: 683-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0455
Family Integrin beta EGF-like domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O61307
Sequence length 2731
Comment (sp|O61307|TENM_DROME) Tenascin-like protein KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=Ten-m; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MNPYEYESTLDCRDVGGGPTPAHAHPHAQGRTLPMSGHGRPTTDLGPVHGSQTLQHQNQQ
NLQAAQAAAQSSHYDYEYQHLAHRPPDTANNTAQRTHGRQGFLLEGVTPTAPPDVPPRNP
TMSRMQNGRLTVNNPNDADFEPSCLVRTPSGNVYIPSGNLNINKGSPIDFKSGSACSTPT
KDTLKGYERSTQGCMGPVLPQRSVMNGLPAHHYSAPMNFRKDLVARCSSPWFGIGSISVL
FAFVVMLILLTTTGVIKWNQSPPCSVLVGNEASEVTAAKSTNTDLSKLHNSSVRAKNGQG
IGLAQGQSGLGAAGVGSGGGSSAATVTTATSNSGTAQGLQSTSASAEATSSAATSSSQSS
LTPSLSSSLANANNGGARTFPARSFPPDGTTFGQITLGQKLTKEIQPYSYWNMQFYQSEP
AYVKFDYTIPRGASIGVYGRRNALPTHTQYHFKEVLSGFSASTRTARAAHLSITREVTRY
MEPGHWFVSLYNDDGDVQELTFYAAVAEDMTQNCPNGCSGNGQCLLGHCQCNPGFGGDDC
SESVCPVLCSQHGEYTNGECICNPGWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGY
KGKFCEEVDCPHPNCSGHGFCADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLD
TQTCTCEAKWSGDDCSKELCDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQ
CKNGTCLCVTGWNGKHCTIEGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELN
CGDSKDNDKDGLVDCEDPECCASHVCKTSQLCVSAPKPIDVLLRKQPPAITASFFERMKF
LIDESSLQNYAKLETFNESRSAVIRGRVVTSLGMGLVGVRVSTTTLLEGFTLTRDDGWFD
LMVNGGGAVTLQFGRAPFRPQSRIVQVPWNEVVIIDLVVMSMSEEKGLAVTTTHTCFAHD
YDLMKPVVLASWKHGFQGACPDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTI
KLQLTPDVIPTSLHLIHLRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAV
VKVGYQYTDCTDIVWDIQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYL
RNKPRIILTTMGDGHQRPLECPDCDGQATKQRLLAPVALAAAPDGSLFVGDFNYIRRIMT
DGSIRTVVKLNATRVSYRYHMALSPLDGTLYVSDPESHQIIRVRDTNDYSQPELNWEAVV
GSGERCLPGDEAHCGDGALAKDAKLAYPKGIAISSDNILYFADGTNIRMVDRDGIVSTLI
GNHMHKSHWKPIPCEGTLKLEEMHLRWPTELAVSPMDNTLHIIDDHMILRMTPDGRVRVI
SGRPLHCATASTAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIGTDGRI
APFAGAESKCNCLERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIRSVM
SSIPEASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTV
TDAAGNKVFLLRDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPTGL
LRTKLDSTGRSYVYNYDEFGRLTSAVTPTGRVIELSFDLSVKGAQVKVSENAQKEMSLLI
QGATVIVRNGAAESRTTVDMDGSTTSITPWGHNLQMEVAPYTILAEQSPLLGESYPVPAK
QRTEIAGDLANRFEWRYFVRRQQPLQAGKQSKGPPRPVTEVGRKLRVNGDNVLTLEYDRE
TQSVVVMVDDKQELLNVTYDRTSRPISFRPQSGDYADVDLEYDRFGRLVSWKWGVLQEAY
SFDRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRG
HIHAFSLQTSLGFFKYQYYSPINRHPFEILYNDEGQILAKIHPHQSGKVAFVHDTAGRLE
TILAGLSSTHYTYQDTTSLVKSVEVQEPGFELRREFKYHAGILKDEKLRFGSKNSLASAR
YKYAYDGNARLSGIEMAIDDKELPTTRYKYSQNLGQLEVVQDLKITRNAFNRTVIQDSAK
QFFAIVDYDQHGRVKSVLMNVKNIDVFRLELDYDLRNRIKSQKTTFGRSTAFDKINYNAD
GHVVEVLGTNNWKYLFDENGNTVGVVDQGEKFNLGYDIGDRVIKVGDVEFNNYDARGFVV
KRGEQKYRYNNRGQLIHSFERERFQSWYYYDDRSRLVAWHDNKGNTTQYYYANPRTPHLV
THVHFPKISRTMKLFYDDRDMLIALEHEDQRYYVATDQNGSPLAFFDQNGSIVKEMKRTP
FGRIIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQRQYDPHVGQWMTPLWETLATEMSHPT
DVFIYRYHNNDPINPNKPQNYMIDLDSWLQLFGYDLNNMQSSRYTKLAQYTPQASIKSNT
LAPDFGVISGLECIVEKTSEKFSDFDFVPKPLLKMEPKMRNLLPRVSYRRGVFGEGVLLS
RIGGRALVSVVDGSNSVVQDVVSSVFNNSYFLDLHFSIHDQDVFYFVKDNVLKLRDDNEE
LRRLGGMFNISTHEISDHGGSAAKELRLHGPDAVVIIKYGVDPEQERHRILKHAHKRAVE
RAWELEKQLVAAGFQGRGDWTEEEKEELVQHGDVDGWNGIDIHSIHKYPQLADDPGNVAF
QRDAKRKRRKTGSSHRSASNRRQLKFGELSA
Download sequence
Identical sequences O61307
FBpp0078161 FBpp0078161 NP_524215.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]