SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O70583 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O70583
Domain Number 1 Region: 491-671
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-47
Family SPRY domain 0.0013
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.83e-17
Family B-box zinc-binding domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000116
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 4 Region: 372-496
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000222
Family Fibronectin type III 0.0026
Further Details:      
 
Weak hits

Sequence:  O70583
Domain Number - Region: 109-161
Classification Level Classification E-value
Superfamily RING/U-box 0.0009
Family ZZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O70583
Sequence length 680
Comment (sp|O70583|TRI18_MOUSE) Tripartite motif-containing protein 18 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Mid1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNEPVESINAFQCPTCR
HVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDANTMSSAEKVLCQ
FCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKQNLESNLTNLIKRNTELETL
LAKLIQTCQHVEVNASRQEAKLTEECDLLIEIIQQRRQIIGTKIKEGKVIRLRKLAQQIA
NCKQCLERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFD
TFALDFSREKKLLECLDYLTAPNPPAIREELCTASYDTITVHWTSEDEFSVVSYELQYTI
FTGQANVVNVACDGTCLLGSAGLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFTVKAIN
QAGSRSSEPGKLKTNSQPFRLDPKSAHRKLKVSHDNLTVERDESSSKKSHAPERFAGQGS
YGVAGNVFIDSGRHYWEVVTSGSTWYAIGLAYRSAPKHEWIGKNAASWALCRCHNHWAVR
HDGKETPIAPAPHLRRVGVLLDYDNGSIAFYDALSSVHLHTFHAALAQPVCPTFTVWNKC
LTIVTGLPIPDHLDCTEQRP
Download sequence
Identical sequences O70583
ENSMUSP00000038765 ENSMUSP00000038765 ENSMUSP00000107732 ENSMUSP00000107733 ENSMUSP00000126746 ENSMUSP00000128176 NP_034927.2.92730 XP_017173897.1.92730 XP_017173898.1.92730 XP_017173899.1.92730 10090.ENSMUSP00000107733 ENSMUSP00000038765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]