SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O75600 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O75600
Domain Number 1 Region: 33-412
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.22e-109
Family GABA-aminotransferase-like 0.00000000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O75600
Sequence length 419
Comment (sp|O75600|KBL_HUMAN) Glycine acetyltransferase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GCAT; OC=Catarrhini; Hominidae; Homo.
Sequence
MWPGNAWRAALFWVPRGRRAQSALAQLRGILEGELEGIRGAGTWKSERVITSRQGPHIRV
DGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQSIHKNLEAKIA
RFHQREDAILYPSCYDANAGLFEALLTPEDAVLSDELNHASIIDGIRLCKAHKYRYRHLD
MADLEAKLQEAQKHRLRLVATDGAFSMDGDIAPLQEICCLASRYGALVFMDECHATGFLG
PTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPGPLVSLLRQRARPYLFSNSLPP
AVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISGASHPICPVMLGDARLAS
RMADDMLKRGIFVIGFSYPVVPKGKARIRVQISAVHSEEDIDRCVEAFVEVGRLHGALP
Download sequence
Identical sequences O75600
HR6698 9606.ENSP00000248924 NP_055106.1.87134 NP_055106.1.92137 XP_016884166.1.92137 ENSP00000248924 gi|7657118|ref|NP_055106.1| ENSP00000248924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]