SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O75884 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O75884
Domain Number 1 Region: 8-171
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.69e-27
Family YdeN-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O75884
Sequence length 186
Comment (sp|O75884|RBBP9_HUMAN) Retinoblastoma-binding protein 9 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RBBP9; OC=Catarrhini; Hominidae; Homo.
Sequence
MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITARESIWLPFME
TELHCDEKTIIIGHSSGAIAAMRYAETHRVYAIVLVSAYTSDLGDENERASGYFTRPWQW
EKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKS
LLKVPA
Download sequence
Identical sequences A0A2I3T0Y2 O75884
ENSP00000336866 ENSPTRP00000022789 9598.ENSPTRP00000022789 9606.ENSP00000336866 ENSPTRP00000022789 gi|24119166|ref|NP_006597.2| NP_006597.2.87134 NP_006597.2.92137 XP_003810660.1.60992 XP_009435165.1.37143 GO.35215 HR2978 ENSP00000336866 ENSP00000336866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]