SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O76908 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O76908
Domain Number 1 Region: 19-76
Classification Level Classification E-value
Superfamily RING/U-box 0.0000459
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Weak hits

Sequence:  O76908
Domain Number - Region: 93-127
Classification Level Classification E-value
Superfamily CorA soluble domain-like 0.0379
Family CorA soluble domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O76908
Sequence length 237
Comment (sp|O76908|VILYA_DROME) RING finger protein vilya {ECO:0000303|PubMed:26452093} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG2709 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAKSQAGQTVEPEASKLWIHCNSCCALFCDKKHTFFLLACHHVFCERCVKVSAGRTPSDA
PIFECSTCRRSVRGRQLTNSMPNHFKQLFHPEPFTIGNDFVETFQRGNHRHFDKYKERKE
LEMDKLFKDIEVAKSVCQKRFLEAQMLRVERKKLMQRSRYIKAEVANRKAEMHRMAQAYR
SRSLTSQSSSSAQRSARGRPRGRGTATQSSSRRRSTESAKRQQITSFIHPPNNSFDL
Download sequence
Identical sequences O76908
FBpp0070464 FBpp0070464 NP_570026.1.81976 FBpp0070464 7227.FBpp0070464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]