SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O80438 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O80438
Domain Number 1 Region: 22-165
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.61e-30
Family N-acetyl transferase, NAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O80438
Sequence length 190
Comment (sp|O80438|MAK3_ARATH) Protein PHOTOSYNTHESIS ALTERED MUTANT 21 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F16M14.6; OC=Arabidopsis.
Sequence
MEKEMEDKEEFDEGEIEYTSYAGEHHLPLIMSLVDQELSEPYSIFTYRYFVYLWPQLCFL
AFHKGKCVGTIVCKMGDHRQTFRGYIAMLVVIKPYRGRGIASELVTRAIKAMMESGCEEV
TLEAEVSNKGALALYGRLGFIRAKRLYHYYLNGMDAFRLKLLFPKPRVPQIPSQVQTQQE
YETFPRPRVP
Download sequence
Identical sequences O80438
GO.11625 AT2G38130.1 AT2G38130.2 NP_181348.1.80155 NP_973629.1.80155 AT2G38130.1 3702.AT2G38130.2-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]