SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O83999 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O83999
Domain Number 1 Region: 471-491,531-782
Classification Level Classification E-value
Superfamily HAD-like 2.58e-52
Family Meta-cation ATPase, catalytic domain P 0.00024
Further Details:      
 
Domain Number 2 Region: 285-373
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 5.75e-24
Family Calcium ATPase, transduction domain A 0.0032
Further Details:      
 
Domain Number 3 Region: 1-74
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000000000011
Family HMA, heavy metal-associated domain 0.0024
Further Details:      
 
Domain Number 4 Region: 211-253,374-467
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000124
Family Calcium ATPase, transmembrane domain M 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O83999
Sequence length 792
Comment (tr|O83999|O83999_TREPA) p-ATPase superfamily P-type ATPase transporter {ECO:0000313|EMBL:AGN76200.1} KW=Complete proteome; Reference proteome OX=243276 OS=Treponema pallidum (strain Nichols). GN=TPANIC_1036 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MQVSFVVHGISCTACVRRIEEAVRHVTGAYDVYVNPTTSHLYVHTDLHPTEHTLFAQTII
DAVSHAGFKATLLDTHSTTAPLAATQPVHPDFVTLKRRVRTSLCLLVPLMYLSMGHMVHL
PIPGFLHPLKYALSFALVQAFLTLPVLYANRSLFRAGLIALYGAILRRNTATMDSLISLG
SLSSFTYGLFATARIAMGVHANDTALVSHYVADLYFESAAMIVTLVTVGKYLSALSKGRT
SRALTQLLDIKPKTARVIRQVSVPRGASPSSPTTASAASAHETHEIEIEIPAQDVLVGDT
VLVKAGELVPVDGIITSGQATLDESNVTGESIPVEKGRGDSVISASLVSTGFLKFRAERV
GEHTTLAQIISLVEKTAASKVPVTKLVDAVSAYFVPSIVALSLLSGCAWLCAGASAEFAF
SIAVTVLVISCPCVLGLAVPTALMVATGKGAQMGILIKSAQVFQQMARTKVIAFDKTGTL
TLGRPTLSHIHTLHPTYNEEDILHLAYSLEVCSGHPLAAAISVAAQRKGMTPLAITDFNS
EQGLGLRARLVHTSYAKTVMVGNARMMVAHSIDGMDTYLSPSHNLEETPLFVAADKNLVG
VLFVSDPVKVHSSAAIGALHKRGIQTLMLTGDVKHVAHTIAARCGVKKSKAELLPHDKER
EISALKASGMMVAMVGDGVNDAPALASADVGIAIGAGSDIAVESADVVLMRNCIRDVVTL
VDLSIATVRNMKQNLFWAFFYNTLGVPLAAGLGYPFFGLRLTPMLAAAAMSLSSVSVLCN
ALRLNQFQSSSP
Download sequence
Identical sequences A0A0H3BLV8 O83999
gi|15640020|ref|NP_219473.1| gi|189026259|ref|YP_001934031.1| gi|512444473|ref|YP_008119752.1| gi|408502882|ref|YP_006870326.1| gi|378975684|ref|YP_005224295.1| WP_010882480.1.101681 WP_010882480.1.10609 WP_010882480.1.11013 WP_010882480.1.13630 WP_010882480.1.177 WP_010882480.1.22706 WP_010882480.1.24110 WP_010882480.1.24144 WP_010882480.1.26337 WP_010882480.1.28216 WP_010882480.1.31174 WP_010882480.1.34567 WP_010882480.1.35526 WP_010882480.1.38137 WP_010882480.1.38852 WP_010882480.1.39803 WP_010882480.1.41302 WP_010882480.1.42739 WP_010882480.1.42752 WP_010882480.1.43796 WP_010882480.1.44774 WP_010882480.1.45335 WP_010882480.1.49513 WP_010882480.1.50901 WP_010882480.1.51333 WP_010882480.1.6132 WP_010882480.1.61389 WP_010882480.1.63356 WP_010882480.1.72815 WP_010882480.1.73546 WP_010882480.1.74079 WP_010882480.1.78381 WP_010882480.1.79283 WP_010882480.1.82112 WP_010882480.1.89996 WP_010882480.1.90600 WP_010882480.1.90779 WP_010882480.1.92130 WP_010882480.1.98226 WP_010882480.1.98956 WP_010882480.1.99137 WP_010882480.1.99367 243276.TP1036 455434.TPASS_1036 gi|384422529|ref|YP_005631889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]