SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O88754 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O88754
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 1.03e-53
Family Globins 0.000000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O88754
Sequence length 147
Comment (tr|O88754|O88754_RAT) RCG39434, isoform CRA_a {ECO:0000313|EMBL:EDM18108.1} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_39434 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MVHFTAEEKAAIISIWEKVDLEKIGGETLGRLLIVYPWTQRFFDKFGNLSSALAIMGNPR
IRAHGKKVLTSLGSAVENMDNLKETFAHLSELHCDKLHVDPQNFKLLGNMLVIVLSTHFA
KEFTPEVQAAWQKLVMGVANALSHKYH
Download sequence
Identical sequences O88754
NP_742090.1.100692 NP_742090.1.4139 ENSRNOP00000043418 10116.ENSRNOP00000043418 ENSRNOP00000043418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]