SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O88839 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O88839
Domain Number 1 Region: 213-413
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.87e-56
Family Reprolysin-like 0.000055
Further Details:      
 
Domain Number 2 Region: 431-505
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 3.14e-20
Family Blood coagulation inhibitor (disintegrin) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O88839
Sequence length 864
Comment (sp|O88839|ADA15_MOUSE) Metargidin KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Adam15; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MRLALLWALGLLGAGSPRPSPPLPNIGGTEEEQQASPERTLSGSMESRVVQDSPPMSLAD
VLQTGLPEALRISLELDSESHVLELLQNRDLIPGRPTLVWYQPDGTRMVSEGYSLENCCY
RGRVQGHPSSWVSLCACSGIRGLIVLSPERGYTLELGPGDLQRPVISRIQDHLLLGHTCA
PSWHASVPTRAGPDLLLEQHHAHRLKRDVVTETKIVELVIVADNSEVRKYPDFQQLLNRT
LEAALLLDTFFQPLNVRVALVGLEAWTQHNLIEMSSNPAVLLDNFLRWRRTDLLPRLPHD
SAQLVTVTSFSGPMVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHD
SPGHSCPCPGPAPAKSCIMEASTDFLPGLNFSNCSRQALEKALLEGMGSCLFERQPSLAP
MSSLCGNMFVDPGEQCDCGFPDECTDPCCDHFTCQLRPGAQCASDGPCCQNCKLHPAGWL
CRPPTDDCDLPEFCPGDSSQCPSDIRLGDGEPCASGEAVCMHGRCASYARQCQSLWGPGA
QPAAPLCLQTANTRGNAFGSCGRSPGGSYMPCAPRDVMCGQLQCQWGRSQPLLGSVQDRL
SEVLEANGTQLNCSWVDLDLGNDVAQPLLALPGTACGPGLVCIGHRCQPVDLLGAQECRR
KCHGHGVCDSSGHCRCEEGWAPPDCMTQLKATSSLTTGLLLSLLLLLVLVLLGASYWHRA
RLHQRLCQLKGSSCQYRAPQSCPPERPGPPQRAQQMTGTKQASVVSFPVPPSRPLPPNPV
PKKLQAALADRSNPPTRPLPADPVVRRPKSQGPTKPPPPRKPLPANPQGQHPPGDLPGPG
DGSLPLVVPSRPAPPPPAASSLYL
Download sequence
Identical sequences O88839
10090.ENSMUSP00000029676 ENSMUSP00000029676 ENSMUSP00000029676 NP_001032811.2.92730 ENSMUSP00000029676 ENSMUSP00000139147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]