SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O88890 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O88890
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-27
Family SH2 domain 0.0000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O88890
Sequence length 126
Comment (sp|O88890|SH21A_MOUSE) T-cell signal transduction molecule SAP KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Sh2d1a; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MDAVTVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYQGYIYTYRVSQTE
TGSWSAETAPGVHKRFFRKVKNLISAFQKPDQGIVTPLQYPVEKSSGRGPQAPTGRRDSD
ICLNAP
Download sequence
Identical sequences O88890 Q544F1
ENSMUSP00000005839 ENSMUSP00000005839 ENSMUSP00000005839 ENSMUSP00000141070 NP_035494.1.92730 10090.ENSMUSP00000005839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]