SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O89100 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O89100
Domain Number 1 Region: 49-138
Classification Level Classification E-value
Superfamily SH2 domain 1.94e-28
Family SH2 domain 0.00000277
Further Details:      
 
Domain Number 2 Region: 191-213,265-319
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-22
Family SH3-domain 0.0000352
Further Details:      
 
Domain Number 3 Region: 3-53
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000135
Family SH3-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O89100
Sequence length 322
Comment (sp|O89100|GRAP2_MOUSE) Hematopoietic cell-associated adaptor protein GrpL KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Grap2; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIEFPEWFH
EGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTE
KFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRSQGGPHPSGTVGEEIRPS
VNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDINDGHCGL
GSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSW
WTGRLHNKLGLFPANYVAPMMR
Download sequence
Identical sequences O89100 Q3U0E8
ENSMUSP00000046532 10090.ENSMUSP00000046532 ENSMUSP00000046532 ENSMUSP00000046532 NP_001276371.1.92730 NP_034945.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]