SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O96004 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O96004
Domain Number 1 Region: 95-154
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O96004
Sequence length 215
Comment (sp|O96004|HAND1_HUMAN) Extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HAND1; OC=Catarrhini; Hominidae; Homo.
Sequence
MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGG
PPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELREC
IPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRE
LQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ
Download sequence
Identical sequences O96004
9606.ENSP00000231121 gi|4758506|ref|NP_004812.1| ENSP00000231121 NP_004812.1.87134 NP_004812.1.92137 ENSP00000231121 ENSP00000231121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]