SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P00505 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P00505
Domain Number 1 Region: 31-429
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.27e-126
Family AAT-like 0.00000000000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P00505
Sequence length 430
Comment (sp|P00505|AATM_HUMAN) Transaminase A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GOT2; OC=Catarrhini; Hominidae; Homo.
Sequence
MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEV
LKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYR
YYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFA
FFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADE
AKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVS
NLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGY
LAHAIHQVTK
Download sequence
Identical sequences P00505
9606.ENSP00000245206 gi|73486658|ref|NP_002071.2| ENSP00000245206 ENSP00000245206 NP_002071.2.87134 NP_002071.2.92137 ENSP00000245206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]