SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P00817 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P00817
Domain Number 1 Region: 3-283
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.76e-111
Family Inorganic pyrophosphatase 0.000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P00817
Sequence length 287
Comment (sp|P00817|IPYR_YEAST) Pyrophosphate phospho-hydrolase KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=YBR0202; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MTYTTRQIGAKNTLEYKVYIEKDGKPVSAFHDIPLYADKENNIFNMVVEIPRWTNAKLEI
TKEETLNPIIQDTKKGKLRFVRNCFPHHGYIHNYGAFPQTWEDPNVSHPETKAVGDNDPI
DVLEIGETIAYTGQVKQVKALGIMALLDEGETDWKVIAIDINDPLAPKLNDIEDVEKYFP
GLLRATNEWFRIYKIPDGKPENQFAFSGEAKNKKYALDIIKETHDSWKQLIAGKSSDSKG
IDLTNVTLPDTPTYSKAASDAIPPASPKADAPIDKSIDKWFFISGSV
Download sequence
Identical sequences A0A0L8VVW9 A0A250WFW1 A6ZKV8 B3LNC9 B5VDY3 C7GM39 C8Z406 E7K9P9 E7KK57 E7LR48 E7NER2 E7QBD0 G2W919 H0GC88 N1P7Y2 P00817
cath|current|1m38A00/1-282 cath|current|1m38B00/1-282 YBR011C YBR011C NP_009565.1.97178 tr|A6ZKV8|A6ZKV8_YEAS7 YBR011C YBR011C 1m38_A 1m38_B YBR011C YBR011C YBR011C YBR011C YBR011C YBR011C 1m38A YBR011C YBR011c___KOG1626 YBR011C 4932.YBR011C YBR011C YBR011C YBR011C YBR011C YBR011C YBR011C SCRT_02953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]