SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P02165 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P02165
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Globin-like 5.06e-40
Family Globins 0.000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P02165
Sequence length 154
Comment (sp|P02165|MYG_TUPGL) Myoglobin OX=9395 OS=Tupaia glis (Tree shrew). GN=MB; OC=Mammalia; Eutheria; Euarchontoglires; Scandentia; Tupaiidae; Tupaia.
Sequence
MGLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKTEDEMKASE
DLKKHGNTVLSALGGILKKKGQHEAEIKPLAQSHATKHKIPVKYLEFISEAIIQVLQSKH
PGDFGADAQAAMSKALELFRNDIAAKYKELGFQG
Download sequence
Identical sequences P02165
ENSTBEP00000002421 ENSTBEP00000002421 XP_006170382.1.99106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]