SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P03928 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  P03928
Domain Number - Region: 20-50
Classification Level Classification E-value
Superfamily Sec7 domain 0.00785
Family Sec7 domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P03928
Sequence length 68
Comment (sp|P03928|ATP8_HUMAN) F-ATPase subunit 8 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MT-ATP8; OC=Catarrhini; Hominidae; Homo.
Sequence
MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICS
LHSLPPQS
Download sequence
Identical sequences P03928 U5YV54
9606.ENSP00000355265 ENSP00000355265 ENSP00000355265 YP_003024030.1.92137 ENSP00000355265 gi|251831111|ref|YP_003024030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]