SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P05198 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P05198
Domain Number 1 Region: 187-303
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.22e-42
Family eIF-2-alpha, C-terminal domain 0.000000524
Further Details:      
 
Domain Number 2 Region: 90-183
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.31e-33
Family eIF2alpha middle domain-like 0.00000188
Further Details:      
 
Domain Number 3 Region: 11-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.43e-17
Family Cold shock DNA-binding domain-like 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P05198
Sequence length 315
Comment (sp|P05198|IF2A_HUMAN) Eukaryotic translation initiation factor 2 subunit alpha KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=EIF2S1; OC=Catarrhini; Hominidae; Homo.
Sequence
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
Download sequence
Identical sequences A0A096NVP0 A0A0D9RLK1 A0A2K5HV46 A0A2K5P003 A0A2K6A4S2 A0A2K6C3E4 A0A2K6MUQ2 F7EFD7 G1QIP7 G3QGW6 G7PAK4 H2NLK1 H2Q8H4 P05198 Q53XC0
9544.ENSMMUP00000028218 9598.ENSPTRP00000010961 9600.ENSPPYP00000006729 9606.ENSP00000256383 Hs4758256___KOG2916 ENSP00000256383 NP_001244395.1.72884 NP_001270066.1.63531 NP_004085.1.87134 NP_004085.1.92137 XP_003824115.1.60992 XP_004055369.1.27298 XP_007985247.1.81039 XP_007985248.1.81039 XP_011724707.1.29376 XP_011805115.1.43180 XP_011805116.1.43180 XP_011849624.1.47321 XP_011849625.1.47321 XP_011909251.1.92194 XP_012359805.1.23891 XP_015308721.1.63531 XP_017734075.1.44346 XP_017734076.1.44346 XP_510016.1.37143 ENSPPYP00000006729 ENSPTRP00000010961 ENSMMUP00000028218 ENSP00000256383 ENSP00000425299 ENSP00000256383 ENSP00000425299 ENSPTRP00000010961 ENSMMUP00000028218 ENSPPYP00000006729 ENSGGOP00000001580 ENSNLEP00000000790 gi|4758256|ref|NP_004085.1| ENSNLEP00000000790 ENSGGOP00000001580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]