SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P07225 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P07225
Domain Number 1 Region: 266-455
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-35
Family Laminin G-like module 0.00000416
Further Details:      
 
Domain Number 2 Region: 468-669
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-28
Family Laminin G-like module 0.0000384
Further Details:      
 
Domain Number 3 Region: 41-93
Classification Level Classification E-value
Superfamily GLA-domain 2.52e-20
Family GLA-domain 0.00039
Further Details:      
 
Domain Number 4 Region: 120-248
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000408
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  P07225
Domain Number - Region: 241-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000402
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P07225
Sequence length 676
Comment (sp|P07225|PROS_HUMAN) Vitamin K-dependent protein S KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PROS1; OC=Catarrhini; Hominidae; Homo.
Sequence
MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLEETKQGNLERECIE
ELCNKEEAREVFENDPETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQ
CSPLPCNEDGYMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPG
SYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKS
CEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
YLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWLLIALRGGKIE
VQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGL
LETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVE
KGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLV
DSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDL
QRQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFYNGCMEVNINGVQLDLDEAISKHND
IRAHSCPSVWKKTKNS
Download sequence
Identical sequences A0A0S2Z4K3 P07225
gi|192447438|ref|NP_000304.2| 9606.ENSP00000377783 ENSP00000330021 ENSP00000377783 NP_000304.2.87134 NP_000304.2.92137 ENSP00000377783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]